PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G42180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 386aa    MW: 42027.7 Da    PI: 7.8981
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G42180.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB172.54.6e-5433128297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++ yl+kyreleg
  OPUNC01G42180.1  33 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDDYVDPMRRYLNKYRELEG 126
                      89******************************************************************************************** PP

            NF-YB  96 ek 97 
                      ++
  OPUNC01G42180.1 127 DR 128
                      97 PP

2NF-YB142.11.4e-44254345394
            NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       qd++lPianv+rimk  lP +akisk aket+qec++efisfvt+eas++c+re+rkt+ngdd+++a+ +lG+++y+++++ yl++yre e
  OPUNC01G42180.1 254 GQDNLLPIANVGRIMKDGLPPQAKISKRAKETIQECATEFISFVTGEASERCRRERRKTVNGDDICHAMRSLGLDHYADAMHRYLQRYREGE 345
                      69***************************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.6E-5028148IPR009072Histone-fold
SuperFamilySSF471135.74E-3835138IPR009072Histone-fold
PfamPF008082.2E-2638101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-166684No hitNo description
PROSITE patternPS0068506985IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-1685103No hitNo description
PRINTSPR006151.1E-16104122No hitNo description
Gene3DG3DSA:1.10.20.103.2E-41250347IPR009072Histone-fold
SuperFamilySSF471131.32E-32255353IPR009072Histone-fold
PfamPF008086.4E-24259322IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PROSITE patternPS006850289305IPR003956Transcription factor, NFYB/HAP3, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MADQHTHGGE PDGQRRQLLQ GEAAAGDQAE IIKEQDRLLP IANVGRIMKQ ILPPNAKISK  60
EAKETMQECV SEFISFVTGE ASDKCHKEKR KTVNGDDVCW AFGALGFDDY VDPMRRYLNK  120
YRELEGDRAA AAATSRAGGG PGPDHHPSSS SSSAATAAAA AGHFMFNAMD RTDNSNTNNH  180
SRQLKDLEDE VRIKKLAKVA RRHDGKMSRD LNFSGFNQLG RLQPMQGLPR ASSSSTSASR  240
DRDGDGDGGV MTNGQDNLLP IANVGRIMKD GLPPQAKISK RAKETIQECA TEFISFVTGE  300
ASERCRRERR KTVNGDDICH AMRSLGLDHY ADAMHRYLQR YREGEELAAS LNNAGGGAGS  360
RGGGAIQIDV RAELSIFRGN NQGQNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B3e-3932343192Transcription factor HapC (Eurofung)
4g91_B3e-3932343192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032460.0AP003246.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0423A12.
GenBankAP0032660.0AP003266.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0492G09.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015690868.12e-99PREDICTED: transcriptional activator hap3-like
SwissprotO822483e-55NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0E0JTC70.0A0A0E0JTC7_ORYPU; Uncharacterized protein
STRINGOB01G52130.15e-99(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29173887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.16e-54nuclear factor Y, subunit B5